PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00040_0130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family MYB
Protein Properties Length: 1038aa    MW: 110558 Da    PI: 6.8313
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00040_0130genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.71.3e-1877123148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEd++l +av+ + g++Wk+Ia +++  Rt+ qc +rwqk+l
    kfl00040_0130  77 KGGWTPEEDDILRRAVQVHKGKNWKKIATYFP-DRTDVQCLHRWQKVL 123
                      688*****************************.************986 PP

2Myb_DNA-binding61.61.6e-19129175148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEde+++++v+q+G + W+ Ia+ ++ gR +kqc++rw+++l
    kfl00040_0130 129 KGPWTKEEDERIAQLVAQYGAKKWSIIAQNLP-GRIGKQCRERWHNHL 175
                      79******************************.*************97 PP

3Myb_DNA-binding54.33e-17183224346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       WT+eEd  l++a+  +G++ W+ Iar+++ gRt++++k++w++
    kfl00040_0130 183 HWTEEEDAALIRAHSAFGNK-WAEIARYLP-GRTDNNIKNHWNS 224
                      5*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.24472123IPR017930Myb domain
SMARTSM007171.3E-1676125IPR001005SANT/Myb domain
PfamPF002499.6E-1777123IPR001005SANT/Myb domain
SuperFamilySSF466892.15E-1678133IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.5E-2479135IPR009057Homeodomain-like
CDDcd001671.27E-1480123No hitNo description
PROSITE profilePS5129432.393124179IPR017930Myb domain
SuperFamilySSF466894.12E-32126222IPR009057Homeodomain-like
SMARTSM007179.2E-18128177IPR001005SANT/Myb domain
PfamPF002496.6E-18129175IPR001005SANT/Myb domain
CDDcd001671.33E-15131175No hitNo description
Gene3DG3DSA:1.10.10.601.8E-25136181IPR009057Homeodomain-like
SMARTSM007175.6E-17180228IPR001005SANT/Myb domain
PROSITE profilePS5129423.733180230IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-22182230IPR009057Homeodomain-like
PfamPF002492.3E-15183224IPR001005SANT/Myb domain
CDDcd001675.19E-13184226No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0032875Biological Processregulation of DNA endoreduplication
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 1038 aa     Download sequence    Send to blast
MDNQGHMQSE HDAYMAEGGV VYYDDEHMHH AHGNEMALVP VDVGNDEDDM SLSQPSASEG  60
LPPFEGPAGK PKRRSSKGGW TPEEDDILRR AVQVHKGKNW KKIATYFPDR TDVQCLHRWQ  120
KVLNPDLVKG PWTKEEDERI AQLVAQYGAK KWSIIAQNLP GRIGKQCRER WHNHLNPVIK  180
HTHWTEEEDA ALIRAHSAFG NKWAEIARYL PGRTDNNIKN HWNSTVKKKV EQYGEAKLLE  240
MLGADLSVPL VPVEWNPPVE AGHYGDDDDY ETGGYGDEPQ YGCAEYPPPP AYPPQQALPP  300
PQQQRGRKRP FQTPPQQNGG TVPMKLPLPW GGTGPCLNFP PGPVSTLGLL AMQSGARVQT  360
GVQLQPSLEH GYIVRQIAPP PQELPPTVIQ PQATRAQPPQ KVVGASEDLL AAANKAVNEY  420
RLPEYLTGTP DGKLEVIDEQ RGAENESPPH APNSGRLFYE PPKIVSPFAG ASFDSFRSPP  480
EGKASAFSPL GITQVIGGAQ SAFTTPNQVT PSQLFDGISP QSKLRSAAKT FGGTPSIFRK  540
RPRRLDPNPS PVDPNPEPAR ANGEGGPREG GAVRASILEG AAESERRAAG QGNAQDGGGE  600
SVSGPLKRGA EEDETASVGG KERASERGGD REDEANEAGS KRRDGDGDAR EGLVNGATEN  660
GGGTIRGGSS TRYGNGGAGA DANGHVNGSA GSSGLHGKER SSEVNKGANG SGIEVGGSRG  720
GTQKNGVGNG VGQQSLSGSP VRGMMRGGGG RTPPRKTSSI KGPSLNVAVP VHGSVLVEQP  780
FNSLSIAAPS FRVPASRPPL AGGHSHLSKN IKARPIARAS GNSPGLQKAQ PLIPFVASSW  840
TGDGGLVTAV EVRPVPAALP VMDAGDPFVS MTMPAIDSPG WRPWPSPHAR QAAPSPLQRR  900
RDEQELELFM GTGSAVDDPL GMLRHITDQS AAAVEEVENI PVEAALTSPS PRRPGDRGTG  960
LTWLPSPSFR EPFSPSLFDV SLPSPLPLRE PSHLMVPMGQ PSPQASGAST PMAAEQASRE  1020
RGNLETYGPP IRLLKDCR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C2e-70772306159MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-70772306159MYB PROTO-ONCOGENE PROTEIN
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00505DAPTransfer from AT5G11510Download
Motif logo
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.27e-83myb domain protein 3r-4